Web Analysis for Wiaf - wiaf.org
2.17
Rating by CuteStat
wiaf.org is 1 decade 4 years old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, wiaf.org is SAFE to browse.
PageSpeed Score
80
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 5 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.175.95.2)
Family Law Attorney Services : Johnson Law
- familylawlawyerfayettevillenc.com
Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.
Not Applicable
$
8.95
Armando Luna - Technology Consultant | websites, hosting, custom softw
- coolmando.com
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sun, 06 Dec 2015 05:10:51 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Content-Length: 3359
Connection: close
Content-Type: text/html;charset=UTF-8
Date: Sun, 06 Dec 2015 05:10:51 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Content-Length: 3359
Connection: close
Content-Type: text/html;charset=UTF-8
Domain Information
Domain Registrar: | DropCatch.com 1498 LLC |
---|---|
Registration Date: | Aug 27, 2009, 12:00 AM 1 decade 4 years 7 months ago |
Domain Status: |
serverTransferProhibited
|
Owner's E-Mail: | support@viviotech.net |
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns3.hostek.com | 173.245.58.12 | United States of America | |
ns4.hostek.com | 173.245.59.13 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
wiaf.org | A | 14399 |
IP: 184.175.95.2 |
wiaf.org | NS | 21599 |
Target: ns3.hostek.com |
wiaf.org | NS | 21599 |
Target: ns4.hostek.com |
wiaf.org | SOA | 21599 |
MNAME: ns3.hostek.com RNAME: cpanel.hostek.com Serial: 2015082103 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
wiaf.org | MX | 14399 |
Target: wiaf.org |
Full WHOIS Lookup
Domain Name:WIAF.ORG
Domain ID: D156971749-LROR
Creation Date: 2009-08-27T18:18:17Z
Updated Date: 2015-12-04T17:05:27Z
Registry Expiry Date: 2017-08-27T18:18:17Z
Sponsoring Registrar:Tucows Inc. (R11-LROR)
Sponsoring Registrar IANA ID: 69
WHOIS Server:
Referral URL: http://www.tucows.com
Domain Status: serverTransferProhibited -- http://www.icann.org/epp#serverTransferProhibited
Registrant ID:tuC6Uc3jRc0XMPA4
Registrant Name:Hostmaster
Registrant Organization:Vivio Technologies
Registrant Street: POB 345
Registrant City:Walla Walla
Registrant State/Province:Washington
Registrant Postal Code:99362
Registrant Country:US
Registrant Phone:+509.5934207
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:support@viviotech.net
Admin ID:tuUznGA6k9TlXmCM
Admin Name:Domains AOS
Admin Organization:Advanced Online Solutions, Inc.
Admin Street: PO Box 701048
Admin City:Tulsa
Admin State/Province:OK
Admin Postal Code:74170-1048
Admin Country:US
Admin Phone:+1.9183927870
Admin Phone Ext:
Admin Fax: +1.8665655138
Admin Fax Ext:
Admin Email:domains@hostek.com
Tech ID:tuKty31JMNeCZmj7
Tech Name:Domains AOS
Tech Organization:Advanced Online Solutions, Inc.
Tech Street: PO Box 701048
Tech City:Tulsa
Tech State/Province:OK
Tech Postal Code:74170-1048
Tech Country:US
Tech Phone:+1.9183927870
Tech Phone Ext:
Tech Fax: +1.8665655138
Tech Fax Ext:
Tech Email:domains@hostek.com
Name Server:NS4.HOSTEK.COM
Name Server:NS3.HOSTEK.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
Domain ID: D156971749-LROR
Creation Date: 2009-08-27T18:18:17Z
Updated Date: 2015-12-04T17:05:27Z
Registry Expiry Date: 2017-08-27T18:18:17Z
Sponsoring Registrar:Tucows Inc. (R11-LROR)
Sponsoring Registrar IANA ID: 69
WHOIS Server:
Referral URL: http://www.tucows.com
Domain Status: serverTransferProhibited -- http://www.icann.org/epp#serverTransferProhibited
Registrant ID:tuC6Uc3jRc0XMPA4
Registrant Name:Hostmaster
Registrant Organization:Vivio Technologies
Registrant Street: POB 345
Registrant City:Walla Walla
Registrant State/Province:Washington
Registrant Postal Code:99362
Registrant Country:US
Registrant Phone:+509.5934207
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:support@viviotech.net
Admin ID:tuUznGA6k9TlXmCM
Admin Name:Domains AOS
Admin Organization:Advanced Online Solutions, Inc.
Admin Street: PO Box 701048
Admin City:Tulsa
Admin State/Province:OK
Admin Postal Code:74170-1048
Admin Country:US
Admin Phone:+1.9183927870
Admin Phone Ext:
Admin Fax: +1.8665655138
Admin Fax Ext:
Admin Email:domains@hostek.com
Tech ID:tuKty31JMNeCZmj7
Tech Name:Domains AOS
Tech Organization:Advanced Online Solutions, Inc.
Tech Street: PO Box 701048
Tech City:Tulsa
Tech State/Province:OK
Tech Postal Code:74170-1048
Tech Country:US
Tech Phone:+1.9183927870
Tech Phone Ext:
Tech Fax: +1.8665655138
Tech Fax Ext:
Tech Email:domains@hostek.com
Name Server:NS4.HOSTEK.COM
Name Server:NS3.HOSTEK.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.