2.17 Rating by CuteStat

wiaf.org is 1 decade 4 years old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, wiaf.org is SAFE to browse.

PageSpeed Score
80
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.175.95.2

Hosted Country:

United States of America US

Location Latitude:

38.6312

Location Longitude:

-90.1922
Women in the Arts Foundation

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 5
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 184.175.95.2)

Family Law Attorney Services : Johnson Law

- familylawlawyerfayettevillenc.com

Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.

Not Applicable $ 8.95

Grandfamilies

- cssgrandfamilies.org
Not Applicable $ 8.95

403 Forbidden

- familylawattorneyfayettevillenc.com
Not Applicable $ 8.95

Error Occurred While Processing Request

- testosteronetherapyschertz.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 06 Dec 2015 05:10:51 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Content-Length: 3359
Connection: close
Content-Type: text/html;charset=UTF-8

Domain Information

Domain Registrar: DropCatch.com 1498 LLC
Registration Date: Aug 27, 2009, 12:00 AM 1 decade 4 years 7 months ago
Domain Status:
serverTransferProhibited
Owner's E-Mail: support@viviotech.net

Domain Nameserver Information

Host IP Address Country
ns3.hostek.com 173.245.58.12 United States of America United States of America
ns4.hostek.com 173.245.59.13 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
wiaf.org A 14399 IP: 184.175.95.2
wiaf.org NS 21599 Target: ns3.hostek.com
wiaf.org NS 21599 Target: ns4.hostek.com
wiaf.org SOA 21599 MNAME: ns3.hostek.com
RNAME: cpanel.hostek.com
Serial: 2015082103
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
wiaf.org MX 14399 Target: wiaf.org

Full WHOIS Lookup

Domain Name:WIAF.ORG
Domain ID: D156971749-LROR
Creation Date: 2009-08-27T18:18:17Z
Updated Date: 2015-12-04T17:05:27Z
Registry Expiry Date: 2017-08-27T18:18:17Z
Sponsoring Registrar:Tucows Inc. (R11-LROR)
Sponsoring Registrar IANA ID: 69
WHOIS Server:
Referral URL: http://www.tucows.com
Domain Status: serverTransferProhibited -- http://www.icann.org/epp#serverTransferProhibited
Registrant ID:tuC6Uc3jRc0XMPA4
Registrant Name:Hostmaster
Registrant Organization:Vivio Technologies
Registrant Street: POB 345
Registrant City:Walla Walla
Registrant State/Province:Washington
Registrant Postal Code:99362
Registrant Country:US
Registrant Phone:+509.5934207
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:support@viviotech.net
Admin ID:tuUznGA6k9TlXmCM
Admin Name:Domains AOS
Admin Organization:Advanced Online Solutions, Inc.
Admin Street: PO Box 701048
Admin City:Tulsa
Admin State/Province:OK
Admin Postal Code:74170-1048
Admin Country:US
Admin Phone:+1.9183927870
Admin Phone Ext:
Admin Fax: +1.8665655138
Admin Fax Ext:
Admin Email:domains@hostek.com
Tech ID:tuKty31JMNeCZmj7
Tech Name:Domains AOS
Tech Organization:Advanced Online Solutions, Inc.
Tech Street: PO Box 701048
Tech City:Tulsa
Tech State/Province:OK
Tech Postal Code:74170-1048
Tech Country:US
Tech Phone:+1.9183927870
Tech Phone Ext:
Tech Fax: +1.8665655138
Tech Fax Ext:
Tech Email:domains@hostek.com
Name Server:NS4.HOSTEK.COM
Name Server:NS3.HOSTEK.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.